PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00019.1.g02280.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 851aa    MW: 93288.8 Da    PI: 9.7742
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00019.1.g02280.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like31.53.8e-10110133225
                       G2-like   2 prlrWtpeLHerFveaveqLGGse 25 
                                   pr+rWt+ LH++Fv+ave LGG+e
  Zjn_sc00019.1.g02280.1.am.mk 110 PRMRWTTALHAHFVHAVELLGGHE 133
                                   8*********************97 PP

2NAM175.31.8e-545566811128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePw+Lp+k++ +ekewyfFs rd+ky+tg r+nrat+sg
  Zjn_sc00019.1.g02280.1.am.mk 556 LPPGFRFHPTDEELVTYYLTHKVSDFAFAT-RAIADVDLNKCEPWELPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 635
                                   79*************************999.88***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkg kt+Wvmheyrl
  Zjn_sc00019.1.g02280.1.am.mk 636 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGGKTSWVMHEYRL 681
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-7107134IPR009057Homeodomain-like
SuperFamilySSF1019416.02E-63550702IPR003441NAC domain
PROSITE profilePS5100559.423556702IPR003441NAC domain
PfamPF023653.4E-28557681IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 851 aa     Download sequence    Send to blast
MPFLTHAHKL ASYKNHMSYG THDLITKIPS YSISLNKNKL NSLLLRGLDS TATDMAHQDT  60
VHCAIQQKRL HQPDQIQRFK KSSSGSQTLS GGAVRSGNGS GGGKRSSRAP RMRWTTALHA  120
HFVHAVELLG GHESHAEMRD MGFLRRGCEV YGFDAFNYHT SNPAVSARRS RDRAIYHCCA  180
QGRGRVSNDS ALLLATEIIM CGKTHQSSSS ALAGRPLKYT AVLVLPRWWR FGSASGTTTA  240
TMTPGGAVRE APSWCARPPF SQQAPLPLPC PYLMSSHRSR YLLAQNHQVI TINHIQGWKR  300
GPPAQHGTAA HSAGHVETGN SITRPPSWSY SGIASRWSCP TMATTKGSGG AEEQAAQRMK  360
QQVSSSSSMP SLEISLGRQG WQQDQPQPQQ RGKELTLLKC LVKLGHNVHE CCEDLRMLPS  420
SGRSELSIGS PLAGFWSNNE DSATRRWMEL AGNSSLHRGV NVKRRIDASS SILSTSPSPS  480
PVTLAVVFGP RLVRPREPAL EDEEDRPEGG RTCGEGRINS VCSSATIYAP LPERLSPPLP  540
RAGRALRPRV VMEEGLPPGF RFHPTDEELV TYYLTHKVSD FAFATRAIAD VDLNKCEPWE  600
LPSKASMGEK EWYFFSMRDR KYPTGIRTNR ATDSGYWKTT GKDKEIFHCG MLVGMKKTLV  660
FYRGRAPKGG KTSWVMHEYR LQNKFPYKPN KEEWVVCRVF KKCQIIKVRP PTDSPTMDSL  720
GELDVSSILS NLTPASVHTS SSAPGEGFGH RVDMNAYMSW MAAANQGAAA AAMIPWAMVP  780
GLLGNVFAAP NQPYAGCSPS QPREIGGVVA NVGGGQAMFG SSVAKVDMEC DQQHQPPPQQ  840
LGIDDSTWGA F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-5355670220168NAC domain-containing protein 19
3swm_B5e-5355670220168NAC domain-containing protein 19
3swm_C5e-5355670220168NAC domain-containing protein 19
3swm_D5e-5355670220168NAC domain-containing protein 19
3swp_A5e-5355670220168NAC domain-containing protein 19
3swp_B5e-5355670220168NAC domain-containing protein 19
3swp_C5e-5355670220168NAC domain-containing protein 19
3swp_D5e-5355670220168NAC domain-containing protein 19
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631711e-169AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-85NAC domain containing protein 58